PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_14739.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 92aa    MW: 10596.9 Da    PI: 10.4046
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_14739.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-132179563
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                             ++ +r+++NRe+ArrsR RK++++  L ++v +L++ N + +++++  + ++ +++s++
  Rsa1.0_14739.1_g00001.1 21 RKRKRMISNRESARRSRMRKQKQLGDLINEVTVLKNDNAKIAEQVDAATRKYVEMESKN 79
                             67899********************************************9999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-151781IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4841982IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.56E-122173No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-102177No hitNo description
PfamPF001705.8E-122179IPR004827Basic-leucine zipper domain
CDDcd147022.34E-132272No hitNo description
PROSITE patternPS0003602439IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MGSKSPDSDN DPRYAAVTDE RKRKRMISNR ESARRSRMRK QKQLGDLINE VTVLKNDNAK  60
IAEQVDAATR KYVEMESKND VLRAQASELT ER
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12041RKRKRMISNRESARRSRMRKQK
23340RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104386.11e-56PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP89e-53BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A078GIB92e-57A0A078GIB9_BRANA; BnaC06g18530D protein
STRINGBra003500.1-P4e-56(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.15e-54basic region/leucine zipper motif 53